The biodiversity of mollusks, particularly cephalopods, has not been exhaustively determined in the Revillagigedos ecoregion, which is a biodiversity hotspot for several marine groups located in the Tropical East Pacific Province. In our study, we detected and examined ocellate octopuses from Socorro and Clarion Islands, and determined their identity using morphological criteria and molecular data from two mitochondrial genes (COIII and COI). The taxon identified was Octopus oculifer, a species considered endemic to the Galapagos Archipelago. In addition, according to our analyses, O. mimus, O. hubbsorum and O. oculifer are very closely related and may represent a species complex comprised of three morphotypes. We found that the evolutionary relationships among octopuses are not determined by the presence of ocelli. This study is the first to report a clade represented by ocellate and non-ocellate species, in addition, the identity of cephalopods in the Revillagigedos was determined with analytical support.

Conus snails produce venoms containing numerous peptides such as the α-conotoxins (α-CTXs), which are well-known nicotinic acetylcholine receptor (nAChR) antagonists. Thirty-eight chromatographic fractions from Conus princeps venom extract were isolated by RP-HPLC. The biological activities of 37 fractions (0.07 µg/µL) were assayed by two-electrode voltage clamp on human α7 nAChRs expressed in Xenopus laevis oocytes. Fractions F7 and F16 notably inhibited the response elicited by acetylcholine by 52.7 ± 15.2% and 59.6 ± 2.5%, respectively. Fraction F7 was purified, and an active peptide (F7-3) was isolated. Using a combination of Edman degradation, mass spectrometry, and RNASeq, we determined the sequence of peptide F7-3: AVKKTCIRSTOGSNWGRCCLTKMCHTLCCARSDCTCVYRSGKGHGCSCTS, with one hydroxyproline (O) and a free C-terminus. The average mass of this peptide, 10,735.54 Da, indicates that it is a homodimer of identical subunits, with 10 disulfide bonds in total. This peptide is clearly similar to αD-CTXs from species of the Indo-Pacific. Therefore, we called it αD-PiXXA. This toxin slowly and reversibly inhibited the ACh-induced response of the hα7 nAChR subtype, with an IC₅₀ of 6.2 μM, and it does not affect the hα3β2 subtype at 6.5 μM.

Humic substances and beneficial microorganisms are key biostimulants for sustainable agriculture and global food security in the face of climate change. Marine bacteria are emerging as a promising source of plant-beneficial microbes, tapping into a microbial diversity as immense as the oceans themselves. However, their potential, limitations, and mechanisms of action––especially in combination with other biostimulants––remain largely unexplored. In this study, we isolated the Streptomyces sp. LAP3 strain from the giant limpet Scutellastra mexicana. We evaluated the efficacy of the marine bacterium, applied alone or in combination with the humic product Leonardite hydrolate (L), in enhancing tomato performance under field conditions. Treatments included: (1) marine Streptomyces (MS), (2) Leonardite hydrolate (L), (3) both biostimulants (MS + L), and (4) a control (CTRL). We assessed growth, photosynthetic performance, antioxidant responses, and fruit yield and quality. Both biostimulants individually improved plant performance, but their combination had a significant synergistic effect, markedly boosting tomato productivity, thermotolerance, and resilience during a heatwave. Enhanced photosynthetic efficiency and antioxidant enzyme activity were associated with improved agronomic traits. These results highlight the potential of combining Streptomyces sp. LAP3 and Leonardite hydrolate as an eco-friendly strategy to increase crop productivity, strengthen stress resilience, promote sustainable agriculture, and reduce reliance on agrochemicals.